PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G20480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 266aa    MW: 27594.9 Da    PI: 9.9504
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G20480.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_119.91.6e-061652072163
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  21 RqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      R RKk+++ e ++ v +L+ eN+ L++e+  l+  + +l +e+
  OPUNC06G20480.1 165 RPRKKMRLPEIKQLVRSLTVENDGLREEMVALQRACTALSKEN 207
                      89***********************************999886 PP

Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MTAADAESCA VAAAADIICS LRGADLAGWT PPWGTAAAKG KGKEVVEEEE ELAWPTVARG  60
KRSRSSRRRS PSRSGSAATK GRWARGSPAS PLDYSGGSGS GSGSAASTSG GEDGAFCSPP  120
RPPPPAAAAA TTPTAAPTPS PAKVDPAGRR QLILPTPPPR PAGQRPRKKM RLPEIKQLVR  180
SLTVENDGLR EEMVALQRAC TALSKENCKL ETRLEQSSKR SGTKSEGQQA RPQPDEPAAK  240
QESQNGFVLP DLNLPAQDMA ADGSAP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1164170RPRKKMR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0035171e-177AP003517.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OSJNBa0062J02.
GenBankAP0040081e-177AP004008.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:OJ1226_A12.
GenBankAP0149621e-177AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015644355.11e-112PREDICTED: translation initiation factor IF-2
TrEMBLA0A0E0LDZ80.0A0A0E0LDZ8_ORYPU; Uncharacterized protein
STRINGOB06G30390.11e-102(Oryza brachyantha)
STRINGBGIOSGA020785-PA1e-101(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37902951